SCOP 1.69: Domain d1ec6b_: 1ec6 B:

Lineage for d1ec6b_ (1ec6 B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (8 proteins)
   an RNA-binding domain

6. Protein Neuro-oncological ventral antigen 2, nova-2, KH3 [54795] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54796] (2 PDB entries)

8. Domain d1ec6b_: 1ec6 B: [38805]

Details for d1ec6b_

PDB Entry: 1ec6, 2.4 Å

PDB Description: crystal structure of nova-2 kh3 k-homology rna-binding domain bound to 20-mer rna hairpin

SCOP Domain Sequences for d1ec6b_:

Sequence; same for both SEQRES and ATOM records:

>d1ec6b_ d.51.1.1 (B:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens)}
mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
atqaaqylisqrvtyeqgvrasnp

Timeline for d1ec6b_:

• d1ec6b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ec6b_ appears in SCOP 1.67
  
• d1ec6b_ appears in SCOP 1.71
  
• d1ec6b_ appears in the current release, SCOPe 2.08, called d1ec6b1