Lineage for d1ec6b_ (1ec6 B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191642Fold d.51: Eukaryotic type KH-domain (eKH-domain) [54790] (1 superfamily)
  4. 191643Superfamily d.51.1: Eukaryotic type KH-domain (eKH-domain) [54791] (1 family) (S)
  5. 191644Family d.51.1.1: Eukaryotic type KH-domain (eKH-domain) [54792] (7 proteins)
  6. 191659Protein Neuro-oncological ventral antigen 2, nova-2, KH3 [54795] (1 species)
  7. 191660Species Human (Homo sapiens) [TaxId:9606] [54796] (2 PDB entries)
  8. 191666Domain d1ec6b_: 1ec6 B: [38805]

Details for d1ec6b_

PDB Entry: 1ec6 (more details), 2.4 Å

PDB Description: crystal structure of nova-2 kh3 k-homology rna-binding domain bound to 20-mer rna hairpin

SCOP Domain Sequences for d1ec6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ec6b_ d.51.1.1 (B:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens)}
mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
atqaaqylisqrvtyeqgvrasnp

SCOP Domain Coordinates for d1ec6b_:

Click to download the PDB-style file with coordinates for d1ec6b_.
(The format of our PDB-style files is described here.)

Timeline for d1ec6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ec6a_