Lineage for d1ec6a_ (1ec6 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648551Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 1648552Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1648553Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 1648590Protein Neuro-oncological ventral antigen 2, nova-2, KH3 [54795] (1 species)
  7. 1648591Species Human (Homo sapiens) [TaxId:9606] [54796] (2 PDB entries)
  8. 1648596Domain d1ec6a_: 1ec6 A: [38804]
    protein/RNA complex

Details for d1ec6a_

PDB Entry: 1ec6 (more details), 2.4 Å

PDB Description: crystal structure of nova-2 kh3 k-homology rna-binding domain bound to 20-mer rna hairpin
PDB Compounds: (A:) RNA-binding protein nova-2

SCOPe Domain Sequences for d1ec6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ec6a_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]}
mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
atqaaqylisqrvtyeqgvrasnpqkv

SCOPe Domain Coordinates for d1ec6a_:

Click to download the PDB-style file with coordinates for d1ec6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ec6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ec6b_