SCOP 1.71: Domain d1dtjc_: 1dtj C:

Lineage for d1dtjc_ (1dtj C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (9 proteins)
   an RNA-binding domain

6. Protein Neuro-oncological ventral antigen 2, nova-2, KH3 [54795] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54796] (2 PDB entries)

8. Domain d1dtjc_: 1dtj C: [38802]

Details for d1dtjc_

PDB Entry: 1dtj, 2 Å

PDB Description: crystal structure of nova-2 kh3 k-homology rna-binding domain

SCOP Domain Sequences for d1dtjc_:

Sequence, based on SEQRES records:

>d1dtjc_ d.51.1.1 (C:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens)}
mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
atqaaqylisqrvt

Sequence, based on observed residues (ATOM records):

>d1dtjc_ d.51.1.1 (C:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens)}
mkelvemavpenlvgailgkggktlveyqeltgariqistrnrrvtitgspaatqaaqyl
isqrvt

Timeline for d1dtjc_:

• d1dtjc_ first appeared (with stable ids) in SCOP 1.55
  
• d1dtjc_ appears in SCOP 1.69
  
• d1dtjc_ appears in SCOP 1.73
  
• d1dtjc_ appears in the current release, SCOPe 2.08