Lineage for d6vrme2 (6vrm E:117-245)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758674Domain d6vrme2: 6vrm E:117-245 [388018]
    Other proteins in same PDB: d6vrma1, d6vrmb1, d6vrmb2, d6vrmd2
    automated match to d3q5ya2

Details for d6vrme2

PDB Entry: 6vrm (more details), 2.61 Å

PDB Description: t cell receptor-p53-hla-a2 complex
PDB Compounds: (E:) TCR 12-6, beta chain

SCOPe Domain Sequences for d6vrme2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vrme2 b.1.1.0 (E:117-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d6vrme2:

Click to download the PDB-style file with coordinates for d6vrme2.
(The format of our PDB-style files is described here.)

Timeline for d6vrme2: