Lineage for d6vkqb2 (6vkq B:797-1011)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000733Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 3000734Protein automated matches [191197] (13 species)
    not a true protein
  7. 3000809Species Human (Homo sapiens) [TaxId:9606] [225406] (56 PDB entries)
  8. 3000915Domain d6vkqb2: 6vkq B:797-1011 [388010]
    Other proteins in same PDB: d6vkqa1, d6vkqb1, d6vkqc1, d6vkqd1
    automated match to d4hhyd2
    complexed with so4, uhb

Details for d6vkqb2

PDB Entry: 6vkq (more details), 2.9 Å

PDB Description: crystal structure of human parp-1 cat domain bound to inhibitor eb-47
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d6vkqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vkqb2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d6vkqb2:

Click to download the PDB-style file with coordinates for d6vkqb2.
(The format of our PDB-style files is described here.)

Timeline for d6vkqb2: