SCOP 1.67: Domain d1dtjb_: 1dtj B:

Lineage for d1dtjb_ (1dtj B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (7 proteins)
   an RNA-binding domain

6. Protein Neuro-oncological ventral antigen 2, nova-2, KH3 [54795] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54796] (2 PDB entries)

8. Domain d1dtjb_: 1dtj B: [38801]

Details for d1dtjb_

PDB Entry: 1dtj, 2 Å

PDB Description: crystal structure of nova-2 kh3 k-homology rna-binding domain

SCOP Domain Sequences for d1dtjb_:

Sequence, based on SEQRES records:

>d1dtjb_ d.51.1.1 (B:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens)}
mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
atqaaqylisqrvtye

Sequence, based on observed residues (ATOM records):

>d1dtjb_ d.51.1.1 (B:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens)}
mkelvemavpenlvgaitlveyqeltgariqistrnrrvtitgspaatqaaqylisqrvt
ye

Timeline for d1dtjb_:

• d1dtjb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dtjb_ appears in SCOP 1.65
  
• d1dtjb_ appears in SCOP 1.69
  
• d1dtjb_ appears in the current release, SCOPe 2.08