Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (7 proteins) an RNA-binding domain |
Protein Neuro-oncological ventral antigen 2, nova-2, KH3 [54795] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54796] (2 PDB entries) |
Domain d1dtjb_: 1dtj B: [38801] |
PDB Entry: 1dtj (more details), 2 Å
SCOP Domain Sequences for d1dtjb_:
Sequence, based on SEQRES records: (download)
>d1dtjb_ d.51.1.1 (B:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens)} mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa atqaaqylisqrvtye
>d1dtjb_ d.51.1.1 (B:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens)} mkelvemavpenlvgaitlveyqeltgariqistrnrrvtitgspaatqaaqylisqrvt ye
Timeline for d1dtjb_: