Lineage for d1dtjb_ (1dtj B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32153Fold d.51: KH-domain [54790] (1 superfamily)
  4. 32154Superfamily d.51.1: KH-domain [54791] (1 family) (S)
  5. 32155Family d.51.1.1: KH-domain [54792] (6 proteins)
  6. 32165Protein Neuro-oncological ventral antigen 2, nova-2, KH3 [54795] (1 species)
  7. 32166Species Human (Homo sapiens) [TaxId:9606] [54796] (2 PDB entries)
  8. 32168Domain d1dtjb_: 1dtj B: [38801]

Details for d1dtjb_

PDB Entry: 1dtj (more details), 2 Å

PDB Description: crystal structure of nova-2 kh3 k-homology rna-binding domain

SCOP Domain Sequences for d1dtjb_:

Sequence, based on SEQRES records: (download)

>d1dtjb_ d.51.1.1 (B:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens)}
mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
atqaaqylisqrvtye

Sequence, based on observed residues (ATOM records): (download)

>d1dtjb_ d.51.1.1 (B:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens)}
mkelvemavpenlvgaitlveyqeltgariqistrnrrvtitgspaatqaaqylisqrvt
ye

SCOP Domain Coordinates for d1dtjb_:

Click to download the PDB-style file with coordinates for d1dtjb_.
(The format of our PDB-style files is described here.)

Timeline for d1dtjb_: