SCOPe 2.08: Domain d6vrne2: 6vrn E:116-243

Lineage for d6vrne2 (6vrn E:116-243)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6vrne2: 6vrn E:116-243 [388007]
   Other proteins in same PDB: d6vrna1, d6vrnb1, d6vrnb2, d6vrnd2
   automated match to d3q5ya2

Details for d6vrne2

PDB Entry: 6vrn, 2.46 Å

PDB Description: t cell receptor-p53-hla-a2 complex

PDB Compounds: (E:) TCR repeptor 38-10, beta chain

SCOPe Domain Sequences for d6vrne2:

Sequence; same for both SEQRES and ATOM records:

>d6vrne2 b.1.1.0 (E:116-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d6vrne2:

• d6vrne2 first appeared in SCOPe 2.07