SCOPe 2.08: Domain d6waxb_: 6wax B:

Lineage for d6waxb_ (6wax B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)

8. Domain d6waxb_: 6wax B: [388000]
   automated match to d3n84b_
   complexed with edo, so4

Details for d6waxb_

PDB Entry: 6wax, 1.5 Å

PDB Description: c-terminal sh2 domain of p120rasgap

PDB Compounds: (B:) Ras GTPase-activating protein 1

SCOPe Domain Sequences for d6waxb_:

Sequence; same for both SEQRES and ATOM records:

>d6waxb_ d.93.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edphegkiwfhgkiskqeaynllmtvgqvssflvrpsdntpgdyslyfrtneniqrfkis
ptpnnqfmmggryynsigdiidhyrkeqivegyylkepvpmq

Timeline for d6waxb_:

• d6waxb_ first appeared in SCOPe 2.07