SCOPe 2.07: Domain d6vkod2: 6vko D:797-1011

Lineage for d6vkod2 (6vko D:797-1011)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.166: ADP-ribosylation [56398] (1 superfamily)
unusual fold
Superfamily d.166.1: ADP-ribosylation [56399] (8 families)
Family d.166.1.0: automated matches [191650] (1 protein)
not a true family
Protein automated matches [191197] (11 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [225406] (51 PDB entries)
Domain d6vkod2: 6vko D:797-1011 [387999]
Other proteins in same PDB: d6vkoa1, d6vkob1, d6vkoc1, d6vkod1
automated match to d4hhyd2
complexed with l1s, so4

Details for d6vkod2

PDB Entry: 6vko (more details), 2.8 Å

PDB Description: crystal structure of human parp-1 cat domain bound to inhibitor uktt15

PDB Compounds: (D:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d6vkod2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vkod2 d.166.1.0 (D:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d6vkod2:

Click to download the PDB-style file with coordinates for d6vkod2.
(The format of our PDB-style files is described here.)

Timeline for d6vkod2: