SCOPe 2.08: Domain d6vkod2: 6vko D:797-1011

Lineage for d6vkod2 (6vko D:797-1011)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries)

8. Domain d6vkod2: 6vko D:797-1011 [387999]
   Other proteins in same PDB: d6vkoa1, d6vkob1, d6vkoc1, d6vkod1
   automated match to d4hhyd2
   complexed with l1s, so4

Details for d6vkod2

PDB Entry: 6vko, 2.8 Å

PDB Description: crystal structure of human parp-1 cat domain bound to inhibitor uktt15

PDB Compounds: (D:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d6vkod2:

Sequence; same for both SEQRES and ATOM records:

>d6vkod2 d.166.1.0 (D:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

Timeline for d6vkod2:

• d6vkod2 first appeared in SCOPe 2.07