Lineage for d6vqoe2 (6vqo E:115-242)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2759233Domain d6vqoe2: 6vqo E:115-242 [387995]
    Other proteins in same PDB: d6vqoa1, d6vqob1, d6vqob2, d6vqod2, d6vqof1, d6vqog1, d6vqog2, d6vqoh2
    automated match to d3q5ya2

Details for d6vqoe2

PDB Entry: 6vqo (more details), 3 Å

PDB Description: t cell receptor-p53-hla-a2 complex
PDB Compounds: (E:) TCR receptor 1a2, beta chain

SCOPe Domain Sequences for d6vqoe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vqoe2 b.1.1.0 (E:115-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d6vqoe2:

Click to download the PDB-style file with coordinates for d6vqoe2.
(The format of our PDB-style files is described here.)

Timeline for d6vqoe2: