Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6vqoe2: 6vqo E:115-242 [387995] Other proteins in same PDB: d6vqoa1, d6vqob1, d6vqob2, d6vqod2, d6vqof1, d6vqog1, d6vqog2, d6vqoh2 automated match to d3q5ya2 |
PDB Entry: 6vqo (more details), 3 Å
SCOPe Domain Sequences for d6vqoe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vqoe2 b.1.1.0 (E:115-242) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d6vqoe2: