![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
![]() | Protein automated matches [191197] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225406] (51 PDB entries) |
![]() | Domain d6vkkd2: 6vkk D:797-1011 [387984] Other proteins in same PDB: d6vkka1, d6vkkb1, d6vkkc1, d6vkkd1 automated match to d4hhyd2 complexed with gol, rpb, so4 |
PDB Entry: 6vkk (more details), 2.1 Å
SCOPe Domain Sequences for d6vkkd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vkkd2 d.166.1.0 (D:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]} lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis sgvndtsllyneyivydiaqvnlkyllklkfnfkt
Timeline for d6vkkd2: