Lineage for d1dq3a2 (1dq3 A:336-414)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722458Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 722611Superfamily d.50.3: YcfA/nrd intein domain [54786] (2 families) (S)
  5. 722612Family d.50.3.1: PI-Pfui intein middle domain [54787] (1 protein)
  6. 722613Protein PI-Pfui intein middle domain [54788] (1 species)
    contains additional C-terminal helix
  7. 722614Species Archaeon Pyrococcus furiosus [TaxId:2261] [54789] (1 PDB entry)
  8. 722615Domain d1dq3a2: 1dq3 A:336-414 [38798]
    Other proteins in same PDB: d1dq3a1, d1dq3a3, d1dq3a4
    complexed with zn

Details for d1dq3a2

PDB Entry: 1dq3 (more details), 2.1 Å

PDB Description: crystal structure of an archaeal intein-encoded homing endonuclease pi-pfui
PDB Compounds: (A:) endonuclease

SCOP Domain Sequences for d1dq3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dq3a2 d.50.3.1 (A:336-414) PI-Pfui intein middle domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}
gnfglplnfnafkewaseygvefktngsqtiaiinderislgqwhtrnrvskavlvkmlr
klyeatkdeevkrmlhlie

SCOP Domain Coordinates for d1dq3a2:

Click to download the PDB-style file with coordinates for d1dq3a2.
(The format of our PDB-style files is described here.)

Timeline for d1dq3a2: