Lineage for d2ypna2 (2ypn A:220-313)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170232Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2170420Superfamily d.50.2: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54782] (2 families) (S)
    automatically mapped to Pfam PF03900
  5. 2170421Family d.50.2.1: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54783] (1 protein)
  6. 2170422Protein Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54784] (1 species)
  7. 2170423Species Escherichia coli [TaxId:562] [54785] (5 PDB entries)
  8. 2170427Domain d2ypna2: 2ypn A:220-313 [38796]
    Other proteins in same PDB: d2ypna1
    complexed with dpm

Details for d2ypna2

PDB Entry: 2ypn (more details), 2.3 Å

PDB Description: hydroxymethylbilane synthase
PDB Compounds: (A:) protein (hydroxymethylbilane synthase)

SCOPe Domain Sequences for d2ypna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ypna2 d.50.2.1 (A:220-313) Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain {Escherichia coli [TaxId: 562]}
nhhetalrvtaeramntrleggcqvpigsyaelidgeiwlralvgapdgsqiirgerrga
pqdaeqmgislaeellnngareilaevyngdapa

SCOPe Domain Coordinates for d2ypna2:

Click to download the PDB-style file with coordinates for d2ypna2.
(The format of our PDB-style files is described here.)

Timeline for d2ypna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ypna1