Lineage for d6v46c_ (6v46 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386159Species Influenza a virus (strain a/turkey/ontario/6118/1968 h8n4) [TaxId:311175] [387901] (1 PDB entry)
  8. 2386161Domain d6v46c_: 6v46 C: [387937]
    Other proteins in same PDB: d6v46b_, d6v46d_, d6v46f_
    automated match to d3ztna_
    complexed with fuc, nag

Details for d6v46c_

PDB Entry: 6v46 (more details), 2.25 Å

PDB Description: the crystal structure of hemagglutinin from a/turkey/ontario/6118/1968 (h8n4)
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6v46c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v46c_ b.19.1.0 (C:) automated matches {Influenza a virus (strain a/turkey/ontario/6118/1968 h8n4) [TaxId: 311175]}
dricigyqsnnstdtvntlieqnvpvtqtmelvetekhpaycntdlgaplelrdckieav
iygnpkcdihlkdqgwsyiverpsapegmcypgsvenleelrfvfssaasykrirlfdys
rwnvtrsgtskacnastggqsfyrsinwltkkkpdtydfnegayvnnedgdiiflwgihh
ppdtkeqttlyknantlssvttntinrsfqpnigprplvrgqqgrmdyywgilkrgetlk
irtngnliapefgyllkgesygriiqnedipigncntkcqtyagainsskpfqnasrhym
gecpkyvkkaslrlavglrntps

SCOPe Domain Coordinates for d6v46c_:

Click to download the PDB-style file with coordinates for d6v46c_.
(The format of our PDB-style files is described here.)

Timeline for d6v46c_: