Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (57 species) not a true protein |
Species Influenza a virus (strain a/turkey/ontario/6118/1968 h8n4) [TaxId:311175] [387901] (1 PDB entry) |
Domain d6v46c_: 6v46 C: [387937] Other proteins in same PDB: d6v46b_, d6v46d_, d6v46f_ automated match to d3ztna_ complexed with fuc, nag |
PDB Entry: 6v46 (more details), 2.25 Å
SCOPe Domain Sequences for d6v46c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v46c_ b.19.1.0 (C:) automated matches {Influenza a virus (strain a/turkey/ontario/6118/1968 h8n4) [TaxId: 311175]} dricigyqsnnstdtvntlieqnvpvtqtmelvetekhpaycntdlgaplelrdckieav iygnpkcdihlkdqgwsyiverpsapegmcypgsvenleelrfvfssaasykrirlfdys rwnvtrsgtskacnastggqsfyrsinwltkkkpdtydfnegayvnnedgdiiflwgihh ppdtkeqttlyknantlssvttntinrsfqpnigprplvrgqqgrmdyywgilkrgetlk irtngnliapefgyllkgesygriiqnedipigncntkcqtyagainsskpfqnasrhym gecpkyvkkaslrlavglrntps
Timeline for d6v46c_: