Lineage for d6v48f_ (6v48 F:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646093Species Influenza a virus (strain a/mallard/gurjev/263/1982 h14n5) [TaxId:352564] [387912] (1 PDB entry)
  8. 2646096Domain d6v48f_: 6v48 F: [387929]
    Other proteins in same PDB: d6v48a_, d6v48c_, d6v48e_, d6v48g_, d6v48i_, d6v48k_
    automated match to d4d00d_
    complexed with nag

Details for d6v48f_

PDB Entry: 6v48 (more details), 3 Å

PDB Description: the crystal structure of hemagglutinin from a/mallard/gurjev/263/1982 (h14n5)
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6v48f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v48f_ h.3.1.1 (F:) automated matches {Influenza a virus (strain a/mallard/gurjev/263/1982 h14n5) [TaxId: 352564]}
aiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektnekyh
qiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfervrr
qlrenaedqgngcfeifhqcdnnciesirngtydhniyrdeainnrik

SCOPe Domain Coordinates for d6v48f_:

Click to download the PDB-style file with coordinates for d6v48f_.
(The format of our PDB-style files is described here.)

Timeline for d6v48f_: