SCOPe 2.08: Domain d1hnwe2: 1hnw E:5-73

Lineage for d1hnwe2 (1hnw E:5-73)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
   automatically mapped to Pfam PF00333

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
   lacks the N-terminal helix

7. Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)
   Uniprot P27152

8. Domain d1hnwe2: 1hnw E:5-73 [38792]
   Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
   complexed with mg, tac, zn

Details for d1hnwe2

PDB Entry: 1hnw, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1hnwe2:

Sequence; same for both SEQRES and ATOM records:

>d1hnwe2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

Timeline for d1hnwe2:

• d1hnwe2 first appeared (with stable ids) in SCOP 1.55
  
• d1hnwe2 appears in SCOPe 2.07