Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza a virus (a/wedge-tailed shearwater/western australia/2576/1979(h15n9)) [TaxId:352560] [387916] (1 PDB entry) |
Domain d6v49c1: 6v49 C:1-328 [387917] Other proteins in same PDB: d6v49a2, d6v49b_, d6v49c2, d6v49d_, d6v49e2, d6v49f_ automated match to d3ztna_ complexed with nag |
PDB Entry: 6v49 (more details), 2.5 Å
SCOPe Domain Sequences for d6v49c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v49c1 b.19.1.0 (C:1-328) automated matches {Influenza a virus (a/wedge-tailed shearwater/western australia/2576/1979(h15n9)) [TaxId: 352560]} dkiclghhavangtkvntltergvevvnatetveitgidkvctkgkkavdlgscgilgti igppqcdlhlefkadliierrnssdicypgrftneealrqiiresggidkesmgfrysgi rtdgatsackrssssfysemkwlsssmnnqvfpqlnqtyrntrkepalivwgvhhsssld eqnklygtgnklitvgsskyqqsfspspgarpkvngqagridfhwmlldpgdtvtftfng afiapdratflrsnapsgieyngkslgiqsdaqidescegecfysggtinsplpfqnids ravgkcpryvkqsslplalgmknvpeki
Timeline for d6v49c1: