Lineage for d1hnze2 (1hnz E:5-73)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79728Fold d.50: dsRBD-like [54767] (3 superfamilies)
  4. 79729Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families) (S)
  5. 79746Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 79747Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)
  7. 79750Species Thermus thermophilus [TaxId:274] [54781] (10 PDB entries)
  8. 79754Domain d1hnze2: 1hnz E:5-73 [38791]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_

Details for d1hnze2

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnze2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnze2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOP Domain Coordinates for d1hnze2:

Click to download the PDB-style file with coordinates for d1hnze2.
(The format of our PDB-style files is described here.)

Timeline for d1hnze2: