Lineage for d1hr0e2 (1hr0 E:5-73)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79728Fold d.50: dsRBD-like [54767] (3 superfamilies)
  4. 79729Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families) (S)
  5. 79746Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 79747Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)
  7. 79750Species Thermus thermophilus [TaxId:274] [54781] (10 PDB entries)
  8. 79755Domain d1hr0e2: 1hr0 E:5-73 [38790]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_

Details for d1hr0e2

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0e2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOP Domain Coordinates for d1hr0e2:

Click to download the PDB-style file with coordinates for d1hr0e2.
(The format of our PDB-style files is described here.)

Timeline for d1hr0e2: