Lineage for d1fjge2 (1fjg E:5-73)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32111Fold d.50: dsRBD-like [54767] (3 superfamilies)
  4. 32112Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families) (S)
  5. 32129Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 32130Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)
  7. 32133Species Thermus thermophilus [TaxId:274] [54781] (6 PDB entries)
  8. 32135Domain d1fjge2: 1fjg E:5-73 [38789]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_

Details for d1fjge2

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjge2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjge2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOP Domain Coordinates for d1fjge2:

Click to download the PDB-style file with coordinates for d1fjge2.
(The format of our PDB-style files is described here.)

Timeline for d1fjge2: