Lineage for d1qu6a1 (1qu6 A:1-90)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190524Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2190525Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2190526Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2190538Protein dsRNA-dependent protein kinase pkr [54774] (2 species)
    contains tandem repeat of two dsRBD
  7. 2190539Species Human (Homo sapiens) [TaxId:9606] [54775] (1 PDB entry)
  8. 2190540Domain d1qu6a1: 1qu6 A:1-90 [38784]

Details for d1qu6a1

PDB Entry: 1qu6 (more details)

PDB Description: structure of the double-stranded rna-binding domain of the protein kinase pkr reveals the molecular basis of its dsrna-mediated activation
PDB Compounds: (A:) protein kinase pkr

SCOPe Domain Sequences for d1qu6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]}
gshmemagdlsagffmeelntyrqkqgvvlkyqelpnsgpphdrrftfqviidgrefpeg
egrskkeaknaaaklaveilnkekkavspl

SCOPe Domain Coordinates for d1qu6a1:

Click to download the PDB-style file with coordinates for d1qu6a1.
(The format of our PDB-style files is described here.)

Timeline for d1qu6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qu6a2