Lineage for d1qu6a1 (1qu6 A:1-90)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.50: dsRBD-like [54767] (3 superfamilies) 
Superfamily d.50.1: dsRNA-binding domain-like [54768] (2 families) 
Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (4 proteins) 
Protein dsRNA-dependent protein kinase pkr [54774] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54775] (1 PDB entry) 
Domain d1qu6a1: 1qu6 A:1-90 [38784]
Details for d1qu6a1
PDB Entry: 1qu6 (more details)
PDB Description: structure of the double-stranded rna-binding domain of the protein kinase pkr reveals the molecular basis of its dsrna-mediated activation
SCOP Domain Sequences for d1qu6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens)}
gshmemagdlsagffmeelntyrqkqgvvlkyqelpnsgpphdrrftfqviidgrefpeg
egrskkeaknaaaklaveilnkekkavspl
SCOP Domain Coordinates for d1qu6a1:
Click to download the PDB-style file with coordinates for d1qu6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qu6a1:
- d1qu6a1 appears in SCOP 1.57
- d1qu6a1 appears in the current release, SCOPe 2.08
View in 3D
