Lineage for d5rkna_ (5rkn A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. Protein automated matches [190615] (14 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1029 PDB entries)
  8. Domain d5rkna_: 5rkn A: [387838]
    automated match to d3mb3a_
    complexed with nua

Details for d5rkna_

PDB Entry: 5rkn (more details), 1.23 Å

PDB Description: pandda analysis group deposition -- crystal structure of phip in complex with z373768900
PDB Compounds: (A:) PH-interacting protein

SCOPe Domain Sequences for d5rkna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5rkna_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydiqawkkqceellnlifqcedsepfrqpvdlleypdyrdiidtpmdfatvretleagny
espmelckdvrlifsnskaytpskrsriysmslrlsaffeehissvlsdyksalrfhkr

SCOPe Domain Coordinates for d5rkna_ are not available.

Timeline for d5rkna_: