Lineage for d5rk0a_ (5rk0 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (14 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1029 PDB entries)
  8. 2707103Domain d5rk0a_: 5rk0 A: [387835]
    automated match to d3mb3a_
    complexed with t0s

Details for d5rk0a_

PDB Entry: 5rk0 (more details), 1.24 Å

PDB Description: pandda analysis group deposition -- crystal structure of phip in complex with z30932204
PDB Compounds: (A:) PH-interacting protein

SCOPe Domain Sequences for d5rk0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5rk0a_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydiqawkkqceellnlifqcedsepfrqpvdlleypdyrdiidtpmdfatvretleagny
espmelckdvrlifsnskaytpskrsriysmslrlsaffeehissvlsdyksalrfhkr

SCOPe Domain Coordinates for d5rk0a_:

Click to download the PDB-style file with coordinates for d5rk0a_.
(The format of our PDB-style files is described here.)

Timeline for d5rk0a_: