Lineage for d5rkxa_ (5rkx A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (14 species)
    not a true protein
  7. 2316984Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 3087743Domain d5rkxa_: 5rkx A: [387805]
    automated match to d3mb3a_
    complexed with ur1

Details for d5rkxa_

PDB Entry: 5rkx (more details), 1.24 Å

PDB Description: pandda analysis group deposition -- crystal structure of phip in complex with z1324080698
PDB Compounds: (A:) PH-interacting protein

SCOPe Domain Sequences for d5rkxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5rkxa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydiqawkkqceellnlifqcedsepfrqpvdlleypdyrdiidtpmdfatvretleagny
espmelckdvrlifsnskaytpskrsriysmslrlsaffeehissvlsdyksalrfhkr

SCOPe Domain Coordinates for d5rkxa_:

Click to download the PDB-style file with coordinates for d5rkxa_.
(The format of our PDB-style files is described here.)

Timeline for d5rkxa_:

  • d5rkxa_ is new in SCOPe 2.07-stable