Lineage for d1914__ (1914 -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32098Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
  4. 32099Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (1 family) (S)
  5. 32100Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (1 protein)
  6. 32101Protein Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54764] (2 species)
  7. 32109Species Mouse (Mus musculus) [TaxId:10090] [54766] (1 PDB entry)
  8. 32110Domain d1914__: 1914 - [38779]

Details for d1914__

PDB Entry: 1914 (more details), 2.53 Å

PDB Description: signal recognition particle alu rna binding heterodimer, srp9/14

SCOP Domain Sequences for d1914__:

Sequence, based on SEQRES records: (download)

>d1914__ d.49.1.1 (-) Signal recognition particle alu RNA binding heterodimer, SRP9/14 {Mouse (Mus musculus)}
mvlleseqflteltrlfqkcrssgsvfitlkkydgrtkpiprkssveglepaenkcllra
tdgkrkistvvsskevnkfqmaysnllranmdglkkrdkknkskkskpaqggeqklisee
ddsagspmpqfqtweefsraaeklyladpmkvrvvlkyrhvdgnlcikvtddlvclvyrt
dqaqdvkkiekfhsqlmrlmvakesrnv

Sequence, based on observed residues (ATOM records): (download)

>d1914__ d.49.1.1 (-) Signal recognition particle alu RNA binding heterodimer, SRP9/14 {Mouse (Mus musculus)}
mvlleseqflteltrlfqkcrssgsvfitlkkydeglepaenkcllratdgkrkistvvs
skevnkfqmaysnllranmdglkkraqggeqklfqtweefsraaeklyladpmkvrvvlk
yrhvdgnlcikvtddlvclvyrtdqaqdvkkiekfhsqlmrlmvakesrnv

SCOP Domain Coordinates for d1914__:

Click to download the PDB-style file with coordinates for d1914__.
(The format of our PDB-style files is described here.)

Timeline for d1914__: