SCOP 1.57: Domain d1e8sb_: 1e8s B:

Lineage for d1e8sb_ (1e8s B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)

4. Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (1 family)

5. Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (1 protein)

6. Protein Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54764] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54765] (2 PDB entries)

8. Domain d1e8sb_: 1e8s B: [38778]

Details for d1e8sb_

PDB Entry: 1e8s, 4 Å

PDB Description: alu domain of the mammalian srp (potential alu retroposition intermediate)

SCOP Domain Sequences for d1e8sb_:

Sequence, based on SEQRES records:

>d1e8sb_ d.49.1.1 (B:) Signal recognition particle alu RNA binding heterodimer, SRP9/14 {Human (Homo sapiens)}
vlleseqflteltrlfqkcrtsgsvyitlkkydgrtkpipkkgtvegfepadnkcllrat
dgkkkistvvsskevnkfqmaysnllranmdglk

Sequence, based on observed residues (ATOM records):

>d1e8sb_ d.49.1.1 (B:) Signal recognition particle alu RNA binding heterodimer, SRP9/14 {Human (Homo sapiens)}
vlleseqflteltrlfqkcrtsgsvyitlkkydgnkcllratdgkkkistvvsskevnkf
qmaysnllranmdglk

Timeline for d1e8sb_:

• d1e8sb_ first appeared (with stable ids) in SCOP 1.55
  
• d1e8sb_ appears in SCOP 1.59
  
• d1e8sb_ appears in the current release, SCOPe 2.08