Lineage for d1e8sa_ (1e8s A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328307Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
    (beta)-alpha-beta(3)-alpha; 2 layers, alpha/beta
  4. 328308Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (1 family) (S)
  5. 328309Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (2 proteins)
  6. 328317Protein Signal recognition particle 9KDa protein, SRP9 [88845] (2 species)
  7. 328318Species Human (Homo sapiens) [TaxId:9606] [88846] (2 PDB entries)
  8. 328321Domain d1e8sa_: 1e8s A: [38777]
    Other proteins in same PDB: d1e8sb_
    low resolution structure of potential alu retroposition intermediate
    complexed with eu3; mutant

Details for d1e8sa_

PDB Entry: 1e8s (more details), 4 Å

PDB Description: alu domain of the mammalian srp (potential alu retroposition intermediate)

SCOP Domain Sequences for d1e8sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8sa_ d.49.1.1 (A:) Signal recognition particle 9KDa protein, SRP9 {Human (Homo sapiens)}
qtweefsraaeklyladpmkarvvlkyrhsdgnlcvkvtddlvclvyktdqaqdvkkiek
fhsqlmrlmva

SCOP Domain Coordinates for d1e8sa_:

Click to download the PDB-style file with coordinates for d1e8sa_.
(The format of our PDB-style files is described here.)

Timeline for d1e8sa_: