Lineage for d1e8sa_ (1e8s A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256644Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
    (beta)-alpha-beta(3)-alpha; 2 layers, alpha/beta
  4. 256645Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (1 family) (S)
  5. 256646Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (1 protein)
  6. 256647Protein Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54764] (2 species)
  7. 256648Species Human (Homo sapiens) [TaxId:9606] [54765] (2 PDB entries)
  8. 256653Domain d1e8sa_: 1e8s A: [38777]

Details for d1e8sa_

PDB Entry: 1e8s (more details), 4 Å

PDB Description: alu domain of the mammalian srp (potential alu retroposition intermediate)

SCOP Domain Sequences for d1e8sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8sa_ d.49.1.1 (A:) Signal recognition particle alu RNA binding heterodimer, SRP9/14 {Human (Homo sapiens)}
qtweefsraaeklyladpmkarvvlkyrhsdgnlcvkvtddlvclvyktdqaqdvkkiek
fhsqlmrlmva

SCOP Domain Coordinates for d1e8sa_:

Click to download the PDB-style file with coordinates for d1e8sa_.
(The format of our PDB-style files is described here.)

Timeline for d1e8sa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e8sb_