SCOP 1.65: Domain d1e8od_: 1e8o D:

Lineage for d1e8od_ (1e8o D:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
   (beta)-alpha-beta(3)-alpha; 2 layers, alpha/beta

4. Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (1 family)

5. Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (2 proteins)

6. Protein Signal recognition particle 14KDa protein, SRP14 [88848] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88849] (2 PDB entries)

8. Domain d1e8od_: 1e8o D: [38776]
   Other proteins in same PDB: d1e8oa_, d1e8oc_
   complexed with gdp, so4; mutant

Details for d1e8od_

PDB Entry: 1e8o, 3.2 Å

PDB Description: core of the alu domain of the mammalian srp

SCOP Domain Sequences for d1e8od_:

Sequence, based on SEQRES records:

>d1e8od_ d.49.1.1 (D:) Signal recognition particle 14KDa protein, SRP14 {Human (Homo sapiens)}
vlleseqflteltrlfqkcrtsgsvyitlkkydgrtkpipkkgtvegfepadnkcllrat
dgkkkistvvsskevnkfqmaysnllranmdglk

Sequence, based on observed residues (ATOM records):

>d1e8od_ d.49.1.1 (D:) Signal recognition particle 14KDa protein, SRP14 {Human (Homo sapiens)}
vlleseqflteltrlfqkcrtsgsvyitlkkydgnkcllratdgkkkistvvsskevnkf
qmaysnllranmdglk

Timeline for d1e8od_:

• d1e8od_ first appeared (with stable ids) in SCOP 1.55
  
• d1e8od_ appears in SCOP 1.63
  
• d1e8od_ appears in SCOP 1.67
  
• d1e8od_ appears in the current release, SCOPe 2.08