Lineage for d1e8ob_ (1e8o B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32098Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
  4. 32099Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (1 family) (S)
  5. 32100Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (1 protein)
  6. 32101Protein Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54764] (2 species)
  7. 32102Species Human (Homo sapiens) [TaxId:9606] [54765] (2 PDB entries)
  8. 32104Domain d1e8ob_: 1e8o B: [38775]

Details for d1e8ob_

PDB Entry: 1e8o (more details), 3.2 Å

PDB Description: core of the alu domain of the mammalian srp

SCOP Domain Sequences for d1e8ob_:

Sequence, based on SEQRES records: (download)

>d1e8ob_ d.49.1.1 (B:) Signal recognition particle alu RNA binding heterodimer, SRP9/14 {Human (Homo sapiens)}
vlleseqflteltrlfqkcrtsgsvyitlkkydgrtkpipkkgtvegfepadnkcllrat
dgkkkistvvsskevnkfqmaysnllranmdglk

Sequence, based on observed residues (ATOM records): (download)

>d1e8ob_ d.49.1.1 (B:) Signal recognition particle alu RNA binding heterodimer, SRP9/14 {Human (Homo sapiens)}
vlleseqflteltrlfqkcrtsgsvyitlkkydnkcllratdgkkkistvvsskevnkfq
maysnllranmdglk

SCOP Domain Coordinates for d1e8ob_:

Click to download the PDB-style file with coordinates for d1e8ob_.
(The format of our PDB-style files is described here.)

Timeline for d1e8ob_: