Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (14 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47521] (34 PDB entries) |
Domain d6pawd_: 6paw D: [387749] Other proteins in same PDB: d6pawa_, d6pawb_, d6pawe_, d6pawf_ automated match to d1iq5a_ complexed with ca |
PDB Entry: 6paw (more details), 2.95 Å
SCOPe Domain Sequences for d6pawd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pawd_ a.39.1.5 (D:) Calmodulin {African clawed frog (Xenopus laevis) [TaxId: 8355]} lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti dfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevde mireadidgdgqvnyeefvqmmtak
Timeline for d6pawd_:
View in 3D Domains from other chains: (mouse over for more information) d6pawa_, d6pawb_, d6pawe_, d6pawf_ |