SCOPe 2.07: Domain d6lsaa_: 6lsa A:

Lineage for d6lsaa_ (6lsa A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [197337] (3 PDB entries)

8. Domain d6lsaa_: 6lsa A: [387742]
   automated match to d5b21a_
   complexed with nag

Details for d6lsaa_

PDB Entry: 6lsa, 2.2 Å

PDB Description: complex structure of bovine herpesvirus 1 glycoprotein d and bovine nectin-1 igv

PDB Compounds: (A:) Nectin cell adhesion molecule 1

SCOPe Domain Sequences for d6lsaa_:

Sequence; same for both SEQRES and ATOM records:

>d6lsaa_ b.1.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dsmygfigtdvvlhcsfanplpgvkitqvtwqkatngskqnvaiynpamgvsvlapyrer
veflrpsftdgtirlsrleledegvyicefatfpagnresqlnltvmak

Timeline for d6lsaa_:

• d6lsaa_ is new in SCOPe 2.07-stable
  
• d6lsaa_ appears in the current release, SCOPe 2.08