Lineage for d6k9md1 (6k9m D:221-459)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342566Protein automated matches [190059] (14 species)
    not a true protein
  7. 2342588Species Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries)
  8. 2342967Domain d6k9md1: 6k9m D:221-459 [387741]
    Other proteins in same PDB: d6k9ma2, d6k9mb2, d6k9mc2, d6k9md2
    automated match to d5i4va_
    protein/DNA complex; complexed with d43

Details for d6k9md1

PDB Entry: 6k9m (more details), 2.9 Å

PDB Description: human lxr-beta in complex with an agonist
PDB Compounds: (D:) oxysterols receptor lxr-beta

SCOPe Domain Sequences for d6k9md1:

Sequence, based on SEQRES records: (download)

>d6k9md1 a.123.1.1 (D:221-459) automated matches {Human (Homo sapiens) [TaxId: 9606]}
taaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpasgsasqqrfahftelaiisvq
eivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddf
hraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyv
eallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdv

Sequence, based on observed residues (ATOM records): (download)

>d6k9md1 a.123.1.1 (D:221-459) automated matches {Human (Homo sapiens) [TaxId: 9606]}
taaqelmiqqlvaaqlqcnkrsfsdkvtpwpadpasgsasqqrfahftelaiisvqeivd
fakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhrag
lqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveall
sytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdv

SCOPe Domain Coordinates for d6k9md1:

Click to download the PDB-style file with coordinates for d6k9md1.
(The format of our PDB-style files is described here.)

Timeline for d6k9md1: