SCOP 1.63: Domain d1e8oc_: 1e8o C:

Lineage for d1e8oc_ (1e8o C:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
   (beta)-alpha-beta(3)-alpha; 2 layers, alpha/beta

4. Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (1 family)

5. Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (1 protein)

6. Protein Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54764] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54765] (2 PDB entries)

8. Domain d1e8oc_: 1e8o C: [38774]

Details for d1e8oc_

PDB Entry: 1e8o, 3.2 Å

PDB Description: core of the alu domain of the mammalian srp

SCOP Domain Sequences for d1e8oc_:

Sequence; same for both SEQRES and ATOM records:

>d1e8oc_ d.49.1.1 (C:) Signal recognition particle alu RNA binding heterodimer, SRP9/14 {Human (Homo sapiens)}
qtweefsraaeklyladpmkarvvlkyrhsdgnlcvkvtddlvclvyktdqaqdvkkiek
fhsqlmrlmva

Timeline for d1e8oc_:

• d1e8oc_ first appeared (with stable ids) in SCOP 1.55
  
• d1e8oc_ appears in SCOP 1.61
  
• d1e8oc_ appears in SCOP 1.65
  
• d1e8oc_ appears in the current release, SCOPe 2.08