Lineage for d6knaa_ (6kna A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2502019Protein automated matches [190118] (17 species)
    not a true protein
  7. 3087672Species Autographa californica multiple nucleopolyhedrovirus [TaxId:307456] [387734] (1 PDB entry)
  8. 3087673Domain d6knaa_: 6kna A: [387735]
    automated match to d4k1rb_

Details for d6knaa_

PDB Entry: 6kna (more details)

PDB Description: viral ubiquitin from autographa californica nucleo polyhedrosis virus
PDB Compounds: (A:) Viral ubiquitin

SCOPe Domain Sequences for d6knaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6knaa_ d.15.1.1 (A:) automated matches {Autographa californica multiple nucleopolyhedrovirus [TaxId: 307456]}
mqifiktltgktitaetepaetvadlkqkiadkegvpvdqqrlifagkqledsktmadyn
iqkestlhmvlrlrgg

SCOPe Domain Coordinates for d6knaa_:

Click to download the PDB-style file with coordinates for d6knaa_.
(The format of our PDB-style files is described here.)

Timeline for d6knaa_:

  • d6knaa_ is new in SCOPe 2.07-stable