Lineage for d1e8oa_ (1e8o A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553706Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
    (beta)-alpha-beta(3)-alpha; 2 layers, alpha/beta
  4. 2553707Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (2 families) (S)
  5. 2553708Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (2 proteins)
  6. 2553716Protein Signal recognition particle 9KDa protein, SRP9 [88845] (2 species)
  7. 2553717Species Human (Homo sapiens) [TaxId:9606] [88846] (2 PDB entries)
  8. 2553718Domain d1e8oa_: 1e8o A: [38773]
    Other proteins in same PDB: d1e8ob_, d1e8od_
    complexed with so4

Details for d1e8oa_

PDB Entry: 1e8o (more details), 3.2 Å

PDB Description: core of the alu domain of the mammalian srp
PDB Compounds: (A:) signal recognition particle 9 kda protein

SCOPe Domain Sequences for d1e8oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8oa_ d.49.1.1 (A:) Signal recognition particle 9KDa protein, SRP9 {Human (Homo sapiens) [TaxId: 9606]}
pqyqtweefsraaeklyladpmkarvvlkyrhsdgnlcvkvtddlvclvyktdqaqdvkk
iekfhsqlmrlmva

SCOPe Domain Coordinates for d1e8oa_:

Click to download the PDB-style file with coordinates for d1e8oa_.
(The format of our PDB-style files is described here.)

Timeline for d1e8oa_: