Lineage for d1g18a2 (1g18 A:270-329)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503256Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 503257Superfamily d.48.1: RecA protein, C-terminal domain [54752] (1 family) (S)
  5. 503258Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 503259Protein RecA protein, C-terminal domain [54754] (3 species)
  7. 503272Species Mycobacterium tuberculosis [TaxId:1773] [54756] (6 PDB entries)
  8. 503278Domain d1g18a2: 1g18 A:270-329 [38771]
    Other proteins in same PDB: d1g18a1

Details for d1g18a2

PDB Entry: 1g18 (more details), 3.8 Å

PDB Description: reca-adp-alf4 complex
PDB Compounds: (A:)

SCOP Domain Sequences for d1g18a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g18a2 d.48.1.1 (A:270-329) RecA protein, C-terminal domain {Mycobacterium tuberculosis}
sregslidmgvdqglirksgawftyegeqlgqgkenarnflvenadvadeiekkikeklg

SCOP Domain Coordinates for d1g18a2:

Click to download the PDB-style file with coordinates for d1g18a2.
(The format of our PDB-style files is described here.)

Timeline for d1g18a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g18a1