Lineage for d1g19a2 (1g19 A:270-329)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79699Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
  4. 79700Superfamily d.48.1: RecA protein, C-terminal domain [54752] (1 family) (S)
  5. 79701Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 79702Protein RecA protein, C-terminal domain [54754] (2 species)
  7. 79707Species Mycobacterium tuberculosis [TaxId:1773] [54756] (2 PDB entries)
  8. 79708Domain d1g19a2: 1g19 A:270-329 [38770]
    Other proteins in same PDB: d1g19a1

Details for d1g19a2

PDB Entry: 1g19 (more details), 3 Å

PDB Description: structure of reca protein

SCOP Domain Sequences for d1g19a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g19a2 d.48.1.1 (A:270-329) RecA protein, C-terminal domain {Mycobacterium tuberculosis}
sregslidmgvdqglirksgawftyegeqlgqgkenarnflvenadvadeiekkikeklg

SCOP Domain Coordinates for d1g19a2:

Click to download the PDB-style file with coordinates for d1g19a2.
(The format of our PDB-style files is described here.)

Timeline for d1g19a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g19a1