Lineage for d1aa3__ (1aa3 -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32082Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
  4. 32083Superfamily d.48.1: RecA protein, C-terminal domain [54752] (1 family) (S)
  5. 32084Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 32085Protein RecA protein, C-terminal domain [54754] (2 species)
  7. 32086Species Escherichia coli [TaxId:562] [54755] (3 PDB entries)
  8. 32089Domain d1aa3__: 1aa3 - [38769]

Details for d1aa3__

PDB Entry: 1aa3 (more details)

PDB Description: c-terminal domain of the e. coli reca, nmr, minimized average structure

SCOP Domain Sequences for d1aa3__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aa3__ d.48.1.1 (-) RecA protein, C-terminal domain {Escherichia coli}
infygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrell
lsn

SCOP Domain Coordinates for d1aa3__:

Click to download the PDB-style file with coordinates for d1aa3__.
(The format of our PDB-style files is described here.)

Timeline for d1aa3__: