![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (15 proteins) |
![]() | Protein Complement c1q globular head, A chain [101613] (1 species) hetrotrimer of A, B and C chains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101614] (6 PDB entries) |
![]() | Domain d6z6va_: 6z6v A: [387687] Other proteins in same PDB: d6z6vb_, d6z6vc_, d6z6ve_, d6z6vf_, d6z6vg1, d6z6vg2, d6z6vh1, d6z6vh2 automated match to d2wnva_ complexed with nag |
PDB Entry: 6z6v (more details), 2.19 Å
SCOPe Domain Sequences for d6z6va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z6va_ b.22.1.1 (A:) Complement c1q globular head, A chain {Human (Homo sapiens) [TaxId: 9606]} prpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqweic lsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgsea dsvfsgflifpsa
Timeline for d6z6va_: