Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (17 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries) |
Domain d6y5gb_: 6y5g B: [387684] Other proteins in same PDB: d6y5ga_, d6y5gc_, d6y5ge_ automated match to d1qfub_ complexed with bma, man, nag |
PDB Entry: 6y5g (more details), 3 Å
SCOPe Domain Sequences for d6y5gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6y5gb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
Timeline for d6y5gb_: