Lineage for d6y5gb_ (6y5g B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645520Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)
  8. 2645887Domain d6y5gb_: 6y5g B: [387684]
    Other proteins in same PDB: d6y5ga_, d6y5gc_, d6y5ge_
    automated match to d1qfub_
    complexed with bma, man, nag

Details for d6y5gb_

PDB Entry: 6y5g (more details), 3 Å

PDB Description: ectodomain of x-31 haemagglutinin at ph 8
PDB Compounds: (B:) X-31 Influenza Haemagglutinin HA2

SCOPe Domain Sequences for d6y5gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y5gb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq

SCOPe Domain Coordinates for d6y5gb_:

Click to download the PDB-style file with coordinates for d6y5gb_.
(The format of our PDB-style files is described here.)

Timeline for d6y5gb_: