Lineage for d2reb_2 (2reb 269-328)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411303Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 411304Superfamily d.48.1: RecA protein, C-terminal domain [54752] (1 family) (S)
  5. 411305Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 411306Protein RecA protein, C-terminal domain [54754] (3 species)
  7. 411307Species Escherichia coli [TaxId:562] [54755] (3 PDB entries)
  8. 411308Domain d2reb_2: 2reb 269-328 [38767]
    Other proteins in same PDB: d2reb_1

Details for d2reb_2

PDB Entry: 2reb (more details), 2.3 Å

PDB Description: the structure of the e. coli reca protein monomer and polymer

SCOP Domain Sequences for d2reb_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2reb_2 d.48.1.1 (269-328) RecA protein, C-terminal domain {Escherichia coli}
nfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelll

SCOP Domain Coordinates for d2reb_2:

Click to download the PDB-style file with coordinates for d2reb_2.
(The format of our PDB-style files is described here.)

Timeline for d2reb_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2reb_1