SCOP 1.65: Domain d2reb_2: 2reb 269-328

Lineage for d2reb_2 (2reb 269-328)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
   alpha-beta(3)-alpha(2); 2 layers, alpha/beta

4. Superfamily d.48.1: RecA protein, C-terminal domain [54752] (1 family)

5. Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)

6. Protein RecA protein, C-terminal domain [54754] (3 species)

7. Species Escherichia coli [TaxId:562] [54755] (3 PDB entries)

8. Domain d2reb_2: 2reb 269-328 [38767]
   Other proteins in same PDB: d2reb_1

Details for d2reb_2

PDB Entry: 2reb, 2.3 Å

PDB Description: the structure of the e. coli reca protein monomer and polymer

SCOP Domain Sequences for d2reb_2:

Sequence; same for both SEQRES and ATOM records:

>d2reb_2 d.48.1.1 (269-328) RecA protein, C-terminal domain {Escherichia coli}
nfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelll

Timeline for d2reb_2:

• d2reb_2 first appeared (with stable ids) in SCOP 1.55
  
• d2reb_2 appears in SCOP 1.63
  
• d2reb_2 appears in SCOP 1.67
  
• d2reb_2 appears in the current release, SCOPe 2.08, called d2reba2