SCOPe 2.07: Domain d6z6vh1: 6z6v H:3-124

Lineage for d6z6vh1 (6z6v H:3-124)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)

8. Domain d6z6vh1: 6z6v H:3-124 [387666]
   Other proteins in same PDB: d6z6va_, d6z6vb_, d6z6vc_, d6z6vd_, d6z6ve_, d6z6vf_, d6z6vg2, d6z6vh2
   automated match to d4nc2b_
   complexed with nag

Details for d6z6vh1

PDB Entry: 6z6v, 2.19 Å

PDB Description: globular head of c1q in complex with the nanobody c1qnb75

PDB Compounds: (H:) Nanobody C1q75

SCOPe Domain Sequences for d6z6vh1:

Sequence; same for both SEQRES and ATOM records:

>d6z6vh1 b.1.1.0 (H:3-124) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvetggglvqaggslrlscaasgrtfnndvmawfrqapgterefvalitagggthyad
svkgrfvisrdndknmaylqmnslksedtaiyycgadenppgwpsrwssaydywgqgtqv
tv

Timeline for d6z6vh1:

• d6z6vh1 is new in SCOPe 2.07-stable
  
• d6z6vh1 appears in the current release, SCOPe 2.08