Lineage for d6z6vh1 (6z6v H:3-124)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759403Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)
  8. 2759418Domain d6z6vh1: 6z6v H:3-124 [387666]
    Other proteins in same PDB: d6z6va_, d6z6vb_, d6z6vc_, d6z6vd_, d6z6ve_, d6z6vf_, d6z6vg2, d6z6vh2
    automated match to d4nc2b_
    complexed with nag

Details for d6z6vh1

PDB Entry: 6z6v (more details), 2.19 Å

PDB Description: globular head of c1q in complex with the nanobody c1qnb75
PDB Compounds: (H:) Nanobody C1q75

SCOPe Domain Sequences for d6z6vh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z6vh1 b.1.1.0 (H:3-124) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvetggglvqaggslrlscaasgrtfnndvmawfrqapgterefvalitagggthyad
svkgrfvisrdndknmaylqmnslksedtaiyycgadenppgwpsrwssaydywgqgtqv
tv

SCOPe Domain Coordinates for d6z6vh1:

Click to download the PDB-style file with coordinates for d6z6vh1.
(The format of our PDB-style files is described here.)

Timeline for d6z6vh1: