Lineage for d6z6vf_ (6z6v F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386843Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2386844Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2386845Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2387221Protein automated matches [190204] (3 species)
    not a true protein
  7. 2387222Species Human (Homo sapiens) [TaxId:9606] [186956] (14 PDB entries)
  8. 2387246Domain d6z6vf_: 6z6v F: [387663]
    Other proteins in same PDB: d6z6va_, d6z6vd_, d6z6vg1, d6z6vg2, d6z6vh1, d6z6vh2
    automated match to d2wnvc_
    complexed with nag

Details for d6z6vf_

PDB Entry: 6z6v (more details), 2.19 Å

PDB Description: globular head of c1q in complex with the nanobody c1qnb75
PDB Compounds: (F:) complement c1q subcomponent subunit c

SCOPe Domain Sequences for d6z6vf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z6vf_ b.22.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqkfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhash
tanlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsd
svfsgfllfpd

SCOPe Domain Coordinates for d6z6vf_:

Click to download the PDB-style file with coordinates for d6z6vf_.
(The format of our PDB-style files is described here.)

Timeline for d6z6vf_: