Lineage for d6yt2b1 (6yt2 B:2-289,B:402-496)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849493Protein Monoamine oxidase B [69423] (2 species)
  7. 2849494Species Human (Homo sapiens) [TaxId:9606] [69424] (46 PDB entries)
  8. 2849524Domain d6yt2b1: 6yt2 B:2-289,B:402-496 [387660]
    Other proteins in same PDB: d6yt2a2, d6yt2b2
    automated match to d2xfua1
    complexed with c15, fad, gol, pjw

Details for d6yt2b1

PDB Entry: 6yt2 (more details), 1.8 Å

PDB Description: crystal structure of human monoamine oxidase b in complex with diphenylene iodonium (dpi)
PDB Compounds: (B:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d6yt2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yt2b1 c.3.1.2 (B:2-289,B:402-496) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
snkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyv
gptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrt
mddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevs
alwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqt
renvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygr
vlrqpvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdv
paqpitttflerhlpsvpgllrli

SCOPe Domain Coordinates for d6yt2b1:

Click to download the PDB-style file with coordinates for d6yt2b1.
(The format of our PDB-style files is described here.)

Timeline for d6yt2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6yt2b2